PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 444777
Common NameSELMODRAFT_444777
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family DBB
Protein Properties Length: 357aa    MW: 38352.4 Da    PI: 8.2234
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
444777genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.54.2e-06446541
  zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
               C+ +e+ e+   C  ++  lC++C  + H        H +vp
    444777  4 QCDGCESAEAVVVCCADEAALCRECDIQVHDAnklagkHHRVP 46
              7*****************************5478899977666 PP

2zf-B_box31.92.7e-105485435
  zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHk 35
              + C+ +++k + +fC +++ llC++C +++Hk
    444777 54 TSCDICQDKTAYFFCLEDRALLCHNCDMSIHK 85
              68*****************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.2E-9147IPR000315B-box-type zinc finger
PROSITE profilePS501199.983147IPR000315B-box-type zinc finger
CDDcd000213.46E-8347No hitNo description
PROSITE profilePS501199.5565198IPR000315B-box-type zinc finger
SMARTSM003365.3E-115198IPR000315B-box-type zinc finger
PfamPF006431.2E-85494IPR000315B-box-type zinc finger
CDDcd000213.29E-95498No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MKVQCDGCES AEAVVVCCAD EAALCRECDI QVHDANKLAG KHHRVPLFRP PTRTSCDICQ  60
DKTAYFFCLE DRALLCHNCD MSIHKLTAST SNHRRFLVTG VAASLHTLSG QAPATSPGTP  120
PPKSSHAVPN SNSHSRASKS TKRREHRDHA AASDARRHCQ SSPQTSTSTS TTSTATVITG  180
SNTDNSKSCQ VPGVRKPAAV VTTLPVAPPP PPPPPPPPGD GSRKTSIFEF LTEAVPGWKC  240
DELLNLPDSS SLASSYTFDP KIDANFAWPS ANVSRDQIYF RSVPQMDKLP AGFNATKVVG  300
DPAALKLKTK PGIFLLPEPD DAFLVPDLGL HSAPELPPAV KRRRTYSELD NIFLSR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002981227.10.0hypothetical protein SELMODRAFT_444777
TrEMBLD8SCW90.0D8SCW9_SELML; Putative uncharacterized protein
STRINGEFJ179280.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18041634
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06040.24e-28DBB family protein
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]